SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP007287-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP007287-PA
Domain Number 1 Region: 105-172
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000275
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP007287-PA
Sequence length 228
Comment (Anopheles gambiae)
Sequence
MKHLKAFDEAQNDIKAVQKRLSTSSTILSGIQKNMAHLNLLQIGVLSLIAVGSVFAGNPC
LKGPPVPKNAAECCVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIPRGCCVAECVMNSTS
LYSNGKIDREALTKLYLASTKSMAPEWNKITLDAIDGCFKMADTIKDEIEAGAKLTPAFE
GEQICHPISGTILACMGMTLFAECPAKLFTVNDDCNKLKSYHSKCPFL
Download sequence
Identical sequences Q7PF80
AGAP007287-PA|odorant XP_308532.3.40869 AGAP007287-PA 7165.AGAP007287-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]