SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP009402-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP009402-PA
Domain Number 1 Region: 156-272
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.67e-25
Family Insect pheromone/odorant-binding proteins 0.0036
Further Details:      
 
Domain Number 2 Region: 37-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.44e-23
Family Insect pheromone/odorant-binding proteins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP009402-PA
Sequence length 333
Comment (Anopheles gambiae)
Sequence
MCSNRSAFGLLLLAWLASVTILGVEAYATPPPTTANCTTVSTFDAALQECVVQLGIAPER
LDQEYNLLLYPADRDTMCLVRCIGVLLRFWNDTTGLREATIRQYYEPAPEDQDYQNRTRS
CLAALEPSVTDVCERAHRSFLCYHQHYGYLRKTDRYVPKTPLEMKQIQQDCVDVYGLDPA
RLNHYQDGQFPDDPETQCFVRCVGLRAGLYTDRDGPNIDRMYVQCESCADETLFRAKAGE
CIAAQRRHKLSKCTAAYRTLYHCFRDDQLDLYASLTTAAATAAAMTTTTTTKKSTPPNAI
PALSVRKPSDRAKLSPDAWQLEIILEGLYNQKY
Download sequence
Identical sequences Q8I8Q7
AGAP009402-PA|odorant AGAP009402-PA 7165.AGAP009402-PA XP_310079.3.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]