SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP010648-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP010648-PA
Domain Number 1 Region: 31-144
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.1e-25
Family Insect pheromone/odorant-binding proteins 0.0041
Further Details:      
 
Domain Number 2 Region: 146-254
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000011
Family Insect pheromone/odorant-binding proteins 0.0058
Further Details:      
 
Weak hits

Sequence:  7165.AGAP010648-PA
Domain Number - Region: 291-326
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00732
Family DnaJ/Hsp40 cysteine-rich domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP010648-PA
Sequence length 327
Comment (Anopheles gambiae)
Sequence
MKQLVCIVVFALVTPNLIVAECDTKGLIVEKSFLQSVHDCTEYLQIPKERLGQYMANEFP
PDDETKCLLFCVGVDLGWWNNTCGLQVPAIVSYFQPVQGDKQYEKRTKECLERRVGAIDS
PNSCCQAYETFQCYFQEFGNLVTCPQYVRSTKLQATQAALDCLVMLRYPEKLLKVYASGK
VEDSPETRCLYHCIDLRTGLYTQNGISLPRFFVRDAAYNDLRYLSKETKACRDRIRQSGC
DKCSEVYNTHTECLSGLGEKGYTSGIITAAAKIALTNLCPAVALSYGGRKPSSTCSKASG
TGQVYNLSYPGYKSRMSSCSRCGGRGH
Download sequence
Identical sequences Q8I8S0
7165.AGAP010648-PA AGAP010648-PA|odorant XP_311366.1.40869 AGAP010648-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]