SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP010715-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP010715-PA
Domain Number 1 Region: 1212-1336
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-18
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP010715-PA
Sequence length 1350
Comment (Anopheles gambiae)
Sequence
FGDFFQNILERAEKRAAALGITNTSKFPLSEFNYEADQQGSAAGASPKKKSGGAAGASPK
KKSVTKKHSAPKPPPPTTTVSTRTATDGERTTTVDIGGQDNCDLALEINITTSANLQVDL
GVKELENDGSVKKQWEHNIVRALEGEKENSAEAKSVIRDQSRNQLQRLGTLYSETQDLSS
PVHRTEGRFHEDVKQSSNKPKPKLAKLAMLADSINNWEDDTSHPDITHHRETIVPGRERK
SPISSSSTRQQSPKRAGEARTGASGSSAPGTGATPKKYPAPNPPKSILTATQKTGSNGGG
EPSSGAAGKPVQTKSLKWDQKVMDTLESQGFQRRESTTSKLVYDYKEDKNGQKTDTYRAP
VTASAVSSTSRERNTTQADQADAVKKSAPVSSSSSQPKKVAVGAPKPAGGLVSGRAAMFE
KSSGRRQSILKPGQKDPAEMSLKERMAIFEKNKGAALVPKAAFGISPSIRQITGQKEGGK
SGSSGSGPMSCAAIQGSGFGSITQQAASSKGVAPASPQSKPKVDHDKAAPKVETKATGSA
IRNTVEALMSDTSTISQSEISEEIRRMRQQEMEMLLNRFTKPADMSSDTIEYETQPIPSA
PPMPPEGYLTGSGRKQSKHSAEGNNVHDGTNDSADVMAALDDVKRIRVGPAAKDGRMYPA
LSDIETTATESGDEGAVGDDYTTATVSGSEGSERAYRTCYGEAEDGERELGDEEEDYDEE
EDNERRHFMYSDDDEEANIANVSLGREILQAVKLNDRRTSRGRRQSQEWNGVSFSLDRSG
ASDGTDPLEDSDLIDACLEEALVDEEEEEEDSEAFDTPRKSSVSSNSFSYQKHSGRDRCA
TINEEESAKDPKSGANKRKSGTPRKSQVGTVDYSSPVRSELQVKPSKDDDDMVTLVHTVS
FYRRQQQQNSMTPRKVPRTPVSTKMAATNSSPRAGTSTSTGTEEGEFLVQEKVKKLLDEV
CKQQTIIAQASQALNLCAATIEFSGSTESAEGERHLLVATHRRQAILDEVQRLRVEGCLR
PPGAPTEKGRLTVKEITLPLKQEYMRKLATDQISGHNLVCLLKYNETVLATQTAPTLPGL
LSVRFPDVLQLSNVFADFKITMEIYGMPASREVLPHEIKYHIALGKKKTGSGSSKLLHTP
KGLKSNSRLIMPPVQSPAGPQAVRSPSLTQYGFIIFSLKEIQRTSWTLNPISGCASPLDG
TVNMRVNCELAVTVDYHGFLTMYEDVSGLGAWHRRWCRLQRHTINYWKYPDDEKRKAPIG
SIDLQGCSTQRVGVAPRDICSRLNTLLLEFPRPARDDDVESLKIVRHGKTTIERYLLSAD
SKEERDEWCAHLNKTLALLKAWGASHVTSC
Download sequence
Identical sequences Q7PRK2
AGAP010715-PA 7165.AGAP010715-PA XP_311427.4.40869 AGAP010715-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]