SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP011367-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP011367-PA
Domain Number 1 Region: 73-213
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000513
Family Insect pheromone/odorant-binding proteins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP011367-PA
Sequence length 235
Comment (Anopheles gambiae)
Sequence
MLKLALFVGLVGCVVAYDFQDSFYNEVLMEDLLDNADEPIMFGRFRRSASEVQDDKCKRK
YKCCNDANTENMEKIHEIKKQCFMEVRNKNKADGAYEPVDFFSCERLNKTKMEVICAMEC
VGRKKEVVNEDGTLIEPKLMEFVKSNFAADDWQQPLLAGHIETCVKEAKEKAAKMPREAG
QCSSETSNFGYCMWRQMALACPKDKQVANKRCDRIREKLANNEPLHYYKAELEDM
Download sequence
Identical sequences Q7PJC9
AGAP011367-PA|odorant AGAP011367-PA XP_317953.2.40869 7165.AGAP011367-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]