SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ000653-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ000653-PA
Domain Number 1 Region: 135-238
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000222
Family Insect pheromone/odorant-binding proteins 0.013
Further Details:      
 
Domain Number 2 Region: 25-133
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000196
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ000653-PA
Sequence length 349
Comment (Culex quinquefasciatus)
Sequence
MTWLVLLPYLAVVTALGVRHSAVFKSIHQANLECQRYLGGGGANNETCGSRCEQLVLRGW
SDETGLVCDSYQRYFRPTCDDTDYKNRTRSCIASGWSTAGDVCDRADVSARCCREQYGFL
ERRSPKILRMPEVLVTSSLRQCARILGVAEGELTLYWGVWFQFPEKARRLLRCLVLRQGI
FADDHGLDVDGAYFQYGDNSIGMEEFGESFGRCANRVLAKQYKDRSRSVARTMFQCIPRN
VSFTIDSDDLLPTKLHPLKCMKVFKSKCQVGCSSETIAELCHDLALQVSKNSLNEVLQNL
EVNEEGMLLPSITPSGLLPKVIDECVTTRLNDCLEDCSQHGIQVICSPP
Download sequence
Identical sequences B0W132
XP_001842416.1.94360 CPIJ000653|odorant-binding 7176.CPIJ000653-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]