SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ002953-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ002953-PA
Domain Number 1 Region: 193-426
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-84
Family SSRP1-like 0.00000351
Further Details:      
 
Domain Number 2 Region: 550-620
Classification Level Classification E-value
Superfamily HMG-box 6.55e-21
Family HMG-box 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ002953-PA
Sequence length 728
Comment (Culex quinquefasciatus)
Sequence
MADFLEYGSISSEVRGALCPGKLKMTDTAIVFKNEKTGRVEQINASDIELLNYQRCVGSF
GLRVFLKNGTLHRFMGFTGDEQKIASFAKKNYKLDMLEKELSMRGWNWGTVHFKGSVLSF
DVENKTSFEIPLNHVSQCNTGKNEVTVEFHRNDDAPVSLMEMRFHIPISESADTDPVEAF
QEQVMKQASVISASGDAIAIFREIHCLTPRGRYDIKVFQSFFQLHGKTYDFKIPTSSVLR
LFLLPHKDNRQMFFVISLDPPIKQGQTRYHFLVTLFQMDEETNIELPFTEEELKEKYEDK
LTKELSGPVYEVLGKIMKVINNRKLTGPGTFIGHSGTPAVGCSYKAAAGYIYPLERGFIY
VHKPPVHIRFEEIASVNFARSGGSTRSFDFEIELKTGTIYTFSSIEKEEYGKLFDFISSK
KLHVKNTGKDGKNAYKEDFADSDNENEPDAYLARVKAEAKERDDDGDDDDDSEESTDEDF
NPNQAESDVAEEFDSNVESSSEEDSEGGGGGGSDDEAKKKLKEKKKEKKEKKKERKERKE
KKPKKSKSGGPKRPSTAFMMWLNATRERIKKENPGISVTEIAKKGGEMWKELKDKSEWEG
KAAKAKEEYVEAMKEYKAAGGGGSGDEGGKASGKKRKSEGSPKKTVSTGAAMKGSGFKSK
EYISGDDSSSDDGEDGDKKDSKKAKKAESGSDSEKKKDDKKKSKKSESEASASESEEEEE
EEEDEGSD
Download sequence
Identical sequences B0W787
7176.CPIJ002953-PA CPIJ002953|FACT XP_001844571.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]