SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ007007-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ007007-PA
Domain Number 1 Region: 180-264
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000628
Family Insect pheromone/odorant-binding proteins 0.0094
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ007007-PA
Domain Number - Region: 37-94
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00011
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ007007-PA
Sequence length 316
Comment (Culex quinquefasciatus)
Sequence
MLTTQLNRSCSFDVDGENKRDQSLSLASPAFDPEETRFIFTRCIEQYSTAATEDDSSRLD
RIRGWISWRLDAAEDEQTKCFVACLLNKLKLWQPYLGKFRGEQLQLQHDLYNSFVNWSRE
DVEVFAAGVERTSDVWNCQAVYEGFTVAVAPQIEMFKQLFLLDDEVAASIYADLRYYRNQ
VDIWCTARNYSIPDDRNFHKHMDCIFRGLRYFDRDEVLNVVEILRDFHLAEITNLDDEIT
NTLVLCEVESGSEALSYYRCLLDSSFVEQFKDALDYREIRSSDYFYRLRDVVPSYNRDEI
HQKVNEIHRNYCVVIS
Download sequence
Identical sequences B0WI96
XP_001848430.1.94360 CPIJ007007|D7 7176.CPIJ007007-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]