SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ007909-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ007909-PA
Domain Number 1 Region: 40-106
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000915
Family Tachycitin 0.0073
Further Details:      
 
Domain Number 2 Region: 218-278
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000602
Family Tachycitin 0.011
Further Details:      
 
Domain Number 3 Region: 154-200
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000602
Family Tachycitin 0.0094
Further Details:      
 
Domain Number 4 Region: 338-388
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000288
Family Tachycitin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ007909-PA
Sequence length 391
Comment (Culex quinquefasciatus)
Sequence
MGQQNRLQRVHRWTVGIGFAVQACIPSIAAQNGGNCAIDPRCPRFDTGDSAVLVPHPDCG
KFYKCALGKACEYNCPANLHFNPILLTCDYPHVACCSRDVACTGPTTQGSNQPSGGSGMY
PPIGDITSARPGCVVDSRCSSSEALNSEKPLVLKHSSCEKFYMCSGGEACEVDCPPGLHF
NAQQSRCDYQDAACCDTSIPCARNNLEVPMSSCIPDVRCSLYENPFDPTHLPHPTNCNRF
YKCSYGKACELPCPQGQHFSVAMNRCEFPEVACCDKSIRCSGPYAVSDLYPETRDEPIKP
AEPVEPREEPTKAPNAPTPESIRINTCFEAQQCPDGDGRMNQLMRHNDCTKFFSCFQGTI
CEFVCPIGLHFNERSKVCDKPEIAQCSQGFN
Download sequence
Identical sequences B0WLF9
XP_001849543.1.94360 CPIJ007909|conserved 7176.CPIJ007909-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]