SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ008161-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ008161-PA
Domain Number 1 Region: 158-260
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 9.42e-19
Family Insect pheromone/odorant-binding proteins 0.0091
Further Details:      
 
Domain Number 2 Region: 70-150
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000968
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ008161-PA
Sequence length 309
Comment (Culex quinquefasciatus)
Sequence
MKTPKLSTLNVPQGLLTLSQKSVPFTHMTMKLFWRTLLVASALSCATGRRHNAKLKSLLA
VDRECNQYSTSDSYGQCQTRCQGILGRFWDDSDVVPAVTLGRFYQPDCDDHNYLNRTEQC
LGEVTDHVRRNDDCLRATCTVKCYTDQYGQLDAESPSYIPTTKLQYEQIYHDCAAILQID
PHSIRDLGNPDARCLLRCFMIRQGLYSDAEGPNLDRMYVQCGGYVRPDEFRQKALKCVER
LRYEPLDACSRAYWIAKECVNVKGAVMQNFGGLGGPLGGFVGGSKPGSSSQNALKILFDK
PPVVGGVRF
Download sequence
Identical sequences B0WM62
XP_001849796.1.94360 CPIJ008161|odorant-binding 7176.CPIJ008161-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]