SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ009038-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ009038-PA
Domain Number 1 Region: 16-128
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.62e-23
Family Insect pheromone/odorant-binding proteins 0.006
Further Details:      
 
Domain Number 2 Region: 132-246
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.23e-20
Family Insect pheromone/odorant-binding proteins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ009038-PA
Sequence length 313
Comment (Culex quinquefasciatus)
Sequence
MPPPPPPEVEESHFAYQEKTFRRALDECAEYLEVPAETVEHLVSHRFQTSEQSLKCLIRC
AGINAGWWNDTAGVQGPVIESYFQPSPDDTCFDRRTRECLEARAPLCQDDCSRAYEAFLC
YYHQYGNLRCSQEYIPLPHLEAVQASIDCINILRIPRELIEQYSRAIVPNVPETQCLYRC
QYLAEGLYDPQYGFNHTRFYIRHHDQPAREFLSDETRSCTEHALRDSCDECARVYRARKC
FDNYSTPFFTSRIIQHAAQIILGQRGCDEDELKPQYNSIASGPYVPASHPAPPPPPSSSY
HVSDGGCKYNCRN
Download sequence
Identical sequences B0WPS2
XP_001850706.1.94360 CPIJ009038|odorant 7176.CPIJ009038-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]