SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ011193-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ011193-PA
Domain Number 1 Region: 672-732
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000377
Family PHD domain 0.0045
Further Details:      
 
Domain Number 2 Region: 326-390
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000146
Family PHD domain 0.0097
Further Details:      
 
Domain Number 3 Region: 745-817
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000155
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 626-681
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000332
Family PHD domain 0.015
Further Details:      
 
Domain Number 5 Region: 280-336
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000465
Family PHD domain 0.0088
Further Details:      
 
Domain Number 6 Region: 1573-1619
Classification Level Classification E-value
Superfamily HMG-box 0.000000503
Family HMG-box 0.0026
Further Details:      
 
Domain Number 7 Region: 417-489
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000131
Family PHD domain 0.031
Further Details:      
 
Weak hits

Sequence:  7176.CPIJ011193-PA
Domain Number - Region: 231-273
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0354
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ011193-PA
Sequence length 2934
Comment (Culex quinquefasciatus)
Sequence
MPSDLGIGPQGALKSDSLGESLALVLPSPDESLGGGGGGGPSTASSSVATTPTTAEMMET
DPALLMPAPEESPYFPEKYPGKVCALCALGERSQLGQGEMLRIEVKDSVEVTVAAALSSQ
EDGKGSSGSSPSSGDKSPKTGAITLGIPPLLSSNKRQKGLNKCKNPVITAEYVDELEKIG
HTEPVEFASIKDGGYFYIHRSCASWSFGVGRDAATGTLSNLEVVVAQALSKKCYFCSRYG
ASLVCKMSCPKSFHYPCIAAAGGFQVIQSYNCFCKEHLGQVPLVCTDDINCRQCSALGDV
GNLMMCSICGDHYHGTCVGLAQLPGVRSGWQCGSCKKCQICRVPDSSEGRTVGCEQCDKI
YHASCLRPIMTSIPKYGWKCRCCRICSDCGSRTPGAGASSRWHAHFSVCDSCYQQRNKGF
SCPICHRAYRAAAHREMVKCSGCNKFVHSTCDAEADLSVYHAKKETNPDYEYLCSPCKTA
IHSGRMAAMRRNSSVDDDSMSASQESLNDESMDVDVEPRERIMSGDIGLGKGKPYVASKI
AKKRLGLSLSGTNRPKGTGKGFQKKSRLADFSRKRGPKAKMRGIFGVPGLGLQRPTADSS
SSKASEEEPGGDNRLVLCSAKDKFVLTQDICVMCGAIGTDQEGCLIACTQCGQCYHPYCT
NVKVTKVILQKGWRCLDCTICEGCGQRNDEGRLILCDDCDISYHTYCMDPPLEQVPQGNW
KCKWCAICLKCGTNDPGYNCAWLNNYSECGPCASQVSCPCCGEGYADGELIIQCNQCERW
LHCGCDQIKSENEAERCAEDGYNCLLCRPHDQPPPHLVPKKKLTQTPISTPKSTPKLEEK
IIPLALEGNHYVDGVCLSEHGLHQIKSLQAEFGKRGKRKPKLQLQPPPPLDKDDGILAAI
ESVVAGSSLDNSFDDVKLEPLDPREEAEIYKDGMVWNDPVPPEGFALVTNEQGVVVLRKK
RQRNLQKLGIGGFFVRNRAVRTKDGKEEDEIADGVVPQISEESATSEVKPKKKPIRRKQK
NKLIEIYPTILQDAFFGRPLLNSSAPTKFETQESDDDAKSDVSDDKTIKLTADELKYVEE
MRIKQEEKQAQEQKALQQSMEQEQAVAAKSAQPATASTQQTADEAIKAEEDDNSDTEALK
DVLGLPNDLIEEDFVNRIMNDDEELTKTSAAFDELTADGELGDGLVKATKNELDILSPDF
NLDNLGNMDSKEVEEIFKNVMTDESQESQESMFANSMTPYTSNTSTPSHSIDVTKKALPQ
RYLNTMAMQQHSPQVQQPQQQPPTPTSGPPSMMGDPSMQPQVNLGMQSPQTPQQQQMMNP
MGMPSPHIHQSPQHQPMGGPGPTMMIQSPLQQQPTTPGTPIHTMQTTPTTPQPQHMQMMP
TPPQQQQQQMQPNMSMLQQQQQQMVMNQQQQQLNRGSSNRYLRINSPNSSSRSSPNKSFQ
GYFPTNNSSSSSNNNHNFNRERYPAKSRNRPCKASGFPDPLVAAQWVRWVNRLNSSNFQS
AAGPLWEWFLPLRVVVGTSGGTAVGGGAGPGDISGPIDDSMGPMAGASAAQKMSERMRLD
EPLNELATISSVLYCNTQHPELKLEFPNWADRCKQIFKRWRLLSTEQKQPYLQQARDNRS
AIRMKKSQQQQQQLQQLQQTDPNSVLLGVAAPGVGGGDQLMTNPLQQQQQHLQMQLQQQV
LKPQQPQQQQQQQLIEVQGNSLDDGTDSLDELTSASNSNAISALLDSNTTPSPSNDTNTL
DSLIGEGSNNKLSTSAVTTSTSITTTSMSTCVTTSTNPLVLSGTMSDNATSNVISPAASS
SSECGPGGSNSKPNLLVAANIANTFINLASVSTSVSSSESGVTPGVPLQTQPGPVAGQPV
TTHVMKTFTIGTNRGSIFVPNVIATNISPHFTVHHHQYGLRNGPAPNVTVNPNGNFNTNS
SAVIRPGFAHIRPFLPQNANINFNIIGNQSAIQSPILAASLQTINKIAQQQQQHVPHPLM
PHHHARGTAVNKIINVCPSDGAQKILLATTSPVVQQHQPPGTPSPSYSPQRSQTPNLMTA
SNNPADQQIRVLTPSEIMRTLPSLDAASYENANQHNEPGDSTGSGATTLEHTGNAETPPS
CPSSTNTPTISTATTNSDTTTTTTTTNTCLPLGASASATSTATISCSSSSATTTTVTTTV
VTTTTSTTAPETDQDKINAQQKSMREAEQERQWKQLQQQRAREQQTQQHLMMPDQRMQDP
SNPSLQLQVSTDGSPMGPTASPSPTRTQFVSPVSKNRMVPLGGQNPPSSPVPNFQHPAAM
GGGGRPGMQIPLQQQQQQQQQQQRPLPGQQQRPNQSPFSPQSQPPQSPHEMLPGSPASQS
GLDPFARPPSEGMSDQNYIHHSPQTPRSVGHQSPIQTPNRSPAYSGQPMPNPQTAMRINL
DAGYAQAPGTPRPQFSNQVRPTVYARPGDLFGPVQTSPFTSPRSDGFNQPQPQEGNRQLR
DLLQRQQVPASGPGVVMGQQQQQQPTQQSPQPMQPQSPYGDDQQQQNMGQLGGPPMQTQQ
TLQQPNQQMMQMTAPTADNGTFRQPLPPNMMNRPRLQMPGGVGGIRAQGGPGVIPGGPRL
QIVRTGGQMVITQQNILQQQQLMRQRMQLPVGVNRPDGPFMSPQGPQQMMQQQPQLGQQS
VSQTDQQNIALLAQRLAGEGEAHIPASTAPAPITSGPIAQPQPQQAAAVQAQPGQQPAPD
GSSEIPDSVSAELEKLEQEDNAGIGEVEGVGDIFGGLADDDDELLDSLTAEMGADFNILE
YADPELDTTDGEKSNLLDSLELDEPEGEKAEDKAKAGPSGEVKTEMMDTGEKVEEQKPVP
MGAPQEMVQPAPQLAGPMMQGQMPLMQQQQQQMQMQPMQQQQQVPQGLNPQQASQLQQLI
GVGPGQQMQQQQMQGPPQQLQQQLLAGQMKTVRPNMLTAAHLQQIQQQMQQQQS
Download sequence
Identical sequences B0WUW9
XP_001859681.1.94360 7176.CPIJ011193-PA CPIJ011193|set

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]