SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ017164-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ017164-PA
Domain Number 1 Region: 28-139
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.79e-18
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ017164-PA
Sequence length 333
Comment (Culex quinquefasciatus)
Sequence
MQTLVTIAVALGSLCLVQGNIVHYIFYKSFPSTLRECAQYNEIPDCTLQRYIADSYPCDE
PVKRLIHCTLSGLGAWDDKDGLREHVIRNSFKPTPEDTCYLNRTRECIKNAVAPLAADDF
HGRAYEIFQCYYRQYGNLIDDDQSVPKDTLELAQLTQLSLIIQNLPRCVLIQYSKGDILD
EPHFPELLLLWLIRGGFYDAKQGGIQLANLSSQFGHPELDTPQTEQCIRAAERTVCDEKE
AVKAFTIFKLCLKDITPILRLVKDAAKALVGEEKSCGCCKECSYPAVSPVYNRFHPPGIR
TDDLWIVSPTAYQRLHRGRIQGDDSCTWTELTT
Download sequence
Identical sequences B0XCD4
CPIJ017164|conserved XP_001867306.1.94360 7176.CPIJ017164-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]