SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ018881-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ018881-PA
Domain Number 1 Region: 130-238
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000183
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 
Domain Number 2 Region: 27-122
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000157
Family Insect pheromone/odorant-binding proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ018881-PA
Sequence length 342
Comment (Culex quinquefasciatus)
Sequence
MELLQTFLLIFCVGCSAGTSPDHKIVLKSLQQAELECKQYLRASPTEEAPCEPRCEQILL
RTWTDCRGLGSIPYGRHFRPDPNDADYINRTQLCVDAAMQGATDVCCQGRVVHQCYREQY
GNSAGTPQLAPMSDILIRSTIEDCAKLLQVESLELMLYGLTRFDLSEKARSLMRCVVIRQ
GLYSDEFGPDLDRMYVQYGGYDVEQKVFAQNAQSCVDWLRGQCLDNATLATRIVTQCFPP
GSSPDTLIIPQTVLPLVGSLVDGVLGTMRGLKVLDAVLKPLAPLLIGVPALEVLRQDGQP
LSRILAEQRGQAGGSRLGGPLRYRNVVIFWLRCEQVKTVKFN
Download sequence
Identical sequences B0XHP0
XP_001869162.1.94360 CPIJ018881|tRNA 7176.CPIJ018881-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]