SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0116065 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0116065
Domain Number 1 Region: 572-633
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0034
Further Details:      
 
Domain Number 2 Region: 241-308
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000164
Family PHD domain 0.0079
Further Details:      
 
Domain Number 3 Region: 199-253
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000377
Family PHD domain 0.023
Further Details:      
 
Domain Number 4 Region: 646-712
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000886
Family PHD domain 0.011
Further Details:      
 
Domain Number 5 Region: 525-581
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000111
Family PHD domain 0.018
Further Details:      
 
Domain Number 6 Region: 332-395
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000411
Family PHD domain 0.021
Further Details:      
 
Domain Number 7 Region: 1182-1231
Classification Level Classification E-value
Superfamily HMG-box 0.0000168
Family HMG-box 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0116065
Sequence length 1486
Comment (Drosophila ananassae)
Sequence
MSINVVANMEEKPTSDELPYFPENFPGKVCCLCNLGEKSALGQGAILQLKAPAPNDLKEK
YPTDRLKEDGCRPFYGTKQTPASTSDCNYELDKIGQAEIVHPAEFLDEGFIYVHRMCVMW
SLRKSQITDADAAYFASHFAEFLEQKCNFCGRYGASINCKMKCRQVHHWPCAAAAGCLLI
LESFTVFCTEHLSQVILICSDNNVECLTCSSLGDLSKLIMCSTCGDHFHSTCVGLANLPD
TRSGWNCARCTKCQICRVQDSNDLKYVKCEQCQKIYHASCLRPVISAIPKYGWKCNRCRV
CTDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAASHKEMVKCSWCNK
FVHSTCDEEADLTAYHKKKELNPDYDYVCPNCKSSPAGPGQSQQAIDSIVLSGMDSGSDQ
LSLKDIEIDPLEGKPNIDASMDDFQKFSVGKKKVCFPSTRGKSGKFVLQRMGVMSQINKK
RSTRGKGRQLALPSISSDRCPNRNMDTDLTSDKKMLLCSARDKYILTQDICVMCGSLGIE
SDSAMITCAQCGQCYHPYCAGVKPSRGILQKGWRCLDCTVCEGCGKKNDEARLLLCDECD
ISYHIYCVNPPLETVPTGNWKCSFCTLCQKCGRNPTEKSEFGDSNMPECPPCASQSACNV
CKSAYANGEMIIQCEHCELWSHFLCDTVNAQLTIDHYDSNIYKCLKCRSASKSLLSLMES
KHGDALGSGLQAHLSKTSLNATLAGSGLDVKGLPDRNNMTLASEMSEVAPEALHWIDGVC
LSESGLGMIKSLSTEIKRKRKMRQTMGNGKDGQAEAAEEAQSEKYKDGMVWDGTENAIPE
GFTISTNDEGVHILRKKRQRNLQKLGIGGFSVRNRGLKKDSEEAAAADQLNALMIMDKKK
KIIRKKQKNKLIEAYPVYLQEAFFGKPLLECGEVVMAESDSSDEIDASMKMYFTRPEGKG
PEVETPPVTKSPAKTLKKVKAEKIVPENKTIFIEQMSMGIQQKPPMTPTANVFDPSLTEM
TTVLTNRHPLDTLTSPNIAELDGTNSVNMVAPAEILEKPMRESPVVLVDNYMVPQQQLPQ
DQKFPSQMYLPGNMTVNPPQMNPPQQLHFHQPSDLNLNAQNANKPKMQGMMGQVIMQTDK
RPDEEVKVAEPATENLNAGTQKTAEKMRKDEDLGPMATISAVLYANTEHPNLKELFPNWN
DRCKQILKRWRSLCNDKKAPFLQKAKDNRSALRQRREQNKIPMPPKPQKQEEMGRVWKQQ
PKLKEDQSNMFVTFNGNAYEMATYVSSPAQPTTPHQIMTNVNENLVIKATMQRTTVQATT
PNTMKMATVDNRLELNSVYGAEPIGDKKLRNLLQKNSTEPMLMGNNSDIFLQNDVLRMGM
MQNTPITQNNPMMSISGKSQPSEGRTLEQEVKMGEPQESAASAVELENVGFSDLLGGLGE
GDDDDLLKSLTSEMGDDFNILEYADPELDVNVLNSLDFDDNEKCSA
Download sequence
Identical sequences B3MCM2
FBpp0116065 XP_001959434.1.52611 7217.FBpp0116065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]