SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0117448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0117448
Domain Number 1 Region: 579-773
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-71
Family Sec7 domain 0.0000018
Further Details:      
 
Domain Number 2 Region: 91-110,343-526,1008-1431,1546-1638
Classification Level Classification E-value
Superfamily ARM repeat 1.39e-21
Family PHAT domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0117448
Sequence length 1656
Comment (Drosophila ananassae)
Sequence
MLSTNSTKTKEMFIVRALEKILADKDIRRSHHSQLKKSCDSALEQIKAELISAGQIAEGN
ELPCAALPLPKNDAASIINAETYFLPFELACKSRSPRIVVTALDCLQKLIAYGHLTGSIQ
DSANPGHLLIDRIVVTIYGCFSGPQTDEGVQLQIIKALLTVVTSQHVEIHEFTLLQAVRT
CYDIYLSSKNLVNQTTARATLTQMLNVIFARMENQVYEMPPPPNPINGSIHSEDCNGSTG
GGSSDETSADADEVIASELLAEIITAAYNEAMKDVESGGEGEPVANGNESSHSDHDSVEL
HSENDAVVTAKFTHILQKDAFLVFRALCKLSMKPLPEGHPDPKSHELRSKVLSLHLLLLI
LQNAGPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFELSLSIFVALLSNFKVHLKRQI
EVFFKEIFLNILEANSSSFEHKWMVIQALTRICADAQSVVDIYVNYDCDFSAANLFERLV
NDLSKIAQGRQALELGANPIQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPAPALQV
QSPTATDHDQPDTTIQTTHSGSSHSLNSNQEQFQDLPEALEERKMRKEVMETGIELFNRK
PQKGVQFLQEKQLLGSTCQDIARWLHEDERLDKTVIGNYLGENDEHSKEVMCAYIDAFDF
RQLEVVAALRILLEEFRLPGEAQKIDRLMEKFASRYCECNPQNQLFQSADTVYVLAFSII
MLTTDLHSPQVKHKMTKEQYIKMNRGISDSKADLPEEYLSSIYDEIAEHEIKMKNNSGLL
QPKPTGKQAFITEKRRKLLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKM
AWTPFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAYVQALARFTLLNA
NSPINEMKAKNIDTIKTLIMVAHTDGNYLGSSWLDIVKCISQLELAQLIGTGVRPQFLSG
AQTTLKDSLNPSVKEHIGETSSQSVVVAVDRIFTGSMRLDGDAIVDFVKALCHVSVDELQ
QQQPRMFSLQKIVEISYYNMERIRLQWSRIWQVLGEHFNTVGCNNNEEIAFFALDSLRQL
SMKFMEKGEFSNFRFQKDFLRPFEHIMKKNASPAIRDMVVRCIAQMVNSQAHNIRSGWKN
IFSIFHLAAGDHEEPIVELAFQTTGKIIGDLYQRQFAIMVDSFQDAVKCLSEFATARFAD
TSMESIRLVRTCAQCVHEAPQLFAEHAGMENDASVAEEDRVWVRGWFPMLFSLSCVVNRC
KLDVRTRALTVLFEIVKTYGESFKPNWWKDLFNVIFRIFDNMKLPEHVTEKSEWMTTTCN
HALYAIIDVFTQYFDVLGHLLLEELFAQLHWCVQQSNEQLARSGTNCLENLVISNGFKFN
ESTWDKTCQCILDIFNATLPQELLSWRPKAHSSNSQPQEHNHFEALHIRCVVQLELIQTV
DNIVFFPATSRKEDAETLAQAAADLTGGRNGSQSQLLDCQREEQGMYGYLRTRQLLTLAD
CLMQSHRFAKRFNADQEQRSLLWRAGFKGSVKPNLLKQETSSLACVLRIFFKMYGDENRR
SDWPGIEKELVQVCKEALGYYLSLQSEAHRDAWTSLLLLILTRLLKMSDARFATHVSNYY
SLLCEMMCFDLKPELRSVLRRVFMRIGPVFNIMSAK
Download sequence
Identical sequences B3MN33
FBpp0117448 XP_001962790.1.52611 7217.FBpp0117448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]