SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0118012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0118012
Domain Number 1 Region: 156-186
Classification Level Classification E-value
Superfamily WW domain 0.00000000238
Family WW domain 0.0016
Further Details:      
 
Domain Number 2 Region: 15-65
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000387
Family HkH motif-containing C2H2 finger 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0118012
Sequence length 343
Comment (Drosophila ananassae)
Sequence
MVILNMTEYWKSNERKFCDFCKCWLSDNKASIAFHESGKRHKMNVAKRITDISRSSEKSE
RERQKMDAEIRKMEEAAMKSYAQDVHARGDMTARSISTVMRATASASSSSASSSAGRSRQ
IDPMRLEGDSDEDEDNRRVTVGKVGSDAAAAPDASLWVEGKSDEGHTYYWNVKTNESVWE
KPKEGFLSYEEYERINQLAMDQQQISQEQESLRFRENADEEVARVNRERMKAFRKPDNPK
EKKQKEEKRQTFKTEEEAATKEIGQWQTVEVKAPEAPIDWELPQTDYYNTAPVISAPTEA
EPPVKRFKEKTISGLDEETASSAPATFKRKFIKKGNSRQRVDD
Download sequence
Identical sequences FBpp0118012 7217.FBpp0118012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]