SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0148526 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0148526
Domain Number 1 Region: 219-290
Classification Level Classification E-value
Superfamily WWE domain 3.27e-21
Family WWE domain 0.00012
Further Details:      
 
Domain Number 2 Region: 102-151
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000589
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 147-210
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000183
Family WWE domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0148526
Sequence length 401
Comment (Drosophila grimshawi)
Sequence
MSQQRSTSSKDSEQNASMNTIVNLDDSDDKEDDDDDLQFVGILRPATTTIDLCVLPSTSA
AAAAARAATTTAKKTPSSAAAAESAKSATIETAATASTAESTATLECPICLQTCIHPARL
PCGHIFCFLCVKGVAYKNRRCAMCRREIPAAFLDNPQLVNGIDDICATRATEDGYQWYYE
GRNGGWWEYDLRTSDDIEKAFKASINETQMVNPIQTKPGSSWWQYDDRTSQDIEEAFKKG
DKSCTILVAGYVYIVDLEQLIQQRQNEPTRCRRVKRDLATIPKKGVAGLRIEGNQVASDT
VFTRPSNPTPNAAASLGGASPITTNFISTIAARDAAIRIASDIIGSTLAQADELTRGLAA
SNISSDSASDLSDSICTPPLLLTVKCLFVATLISTIFLKLY
Download sequence
Identical sequences B4IY33
FBpp0148526 7222.FBpp0148526 XP_001985228.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]