SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0151481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0151481
Domain Number 1 Region: 518-882
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.25e-112
Family Histone deacetylase, HDAC 0.0000012
Further Details:      
 
Domain Number 2 Region: 79-435
Classification Level Classification E-value
Superfamily Arginase/deacetylase 1.87e-103
Family Histone deacetylase, HDAC 0.00000185
Further Details:      
 
Domain Number 3 Region: 966-1055
Classification Level Classification E-value
Superfamily RING/U-box 1.53e-16
Family Zf-UBP 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0151481
Sequence length 1098
Comment (Drosophila grimshawi)
Sequence
MLKSKSTLNSTASTATATATNAAIALSSNSSSSCASRKPSPALQEAKRRARNMLKAQSTD
PVVDIFQNAMNAKNMQRGATALIYDDSMSEHRCLWDETHQERPERFTRTMERCRELKLVD
RCLQLKSRLATKEEILKLHSMEHYERLEQTSGVQNDEALEELSSHYDAIFIHPSTFKLSL
LASGSTIELVDQLLLGKAQNGMAIIRPPGHHAMKSEFNGYCYFNNVALAAQHAIDAYQLQ
RILIIDYDVHHGQGTQRFFYNDPRVLYFSIHRYEHGSFWPNLPESDFHAIGSGAGTGYNF
NVPLNAKGMGNGDYLAIFQQLLVPVALEFQPELILVSAGYDAALGCPEGEMEVTPACYPH
LLNPLLPLANARIAVILEGGYCVDSLSEGAALTLRALLGDPCPALVEPLLLPSPELRTAL
LNCIYVHRPYWRCLQLQQTYTPGELEQLQHGAMDATDGAQQLHCVQRIWLGGPIQTVPAV
DQRYPTRGTSVQLSATVVASNTARLRLLRTETQLGVPAMRVCYAYDAQMLLHCNLHDVTH
PEQPQRIRQIHQMHTDYQLVERMKPLQPRTATTDEVCLAHTRAHVNTVRRLAGRKPDELQ
QLGADYNSVYLHPSTFDCATLAAGAVLQAVDSVMRGETRSGICNVRPPGHHAESDHPHGF
CIFNNVAIAAQYAIREYQLERILIVDWDVHHGNGTQHIFESNPKVLYISVHRYENGAFFP
KGPDGNYDVCGKNAGCGFNVNIPWNKKGMGDVEYALAFQQLILPIAYEFNPQLVLVSAGF
DAAIGDPLGGCKVTPEGYGLFTHWLSALAGGRIIVCLEGGYNVNSISYAMTMCTKTLLGD
PVPISSTSASSSSSALGSQTVAFQSCVETLQLCVEQQRKHWKSLVFNSKLPQGSTLGEKN
NNEDFLAVALEQLNITSQGDGDASVPAANIHDDGDGGGQQQISASGTKPKVKALEQKELL
TICALKSCPHLSLLRTAEAPKSIRGKKSACGDCESTVENWLCLSCHQIGCGPHTYGHIEQ
HCQRNKHPLALCLGDMSVRCCECNIAKIVEHPQLDAYKNTMASHLDKFDDGDDNANDDND
DDDVESSYCIVHPERNEP
Download sequence
Identical sequences B4JXG4
XP_001995788.1.65300 FBpp0151481 7222.FBpp0151481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]