SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0155599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0155599
Domain Number 1 Region: 577-638
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000377
Family PHD domain 0.0037
Further Details:      
 
Domain Number 2 Region: 651-719
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000952
Family PHD domain 0.011
Further Details:      
 
Domain Number 3 Region: 262-315
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000162
Family PHD domain 0.0062
Further Details:      
 
Domain Number 4 Region: 209-262
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000104
Family PHD domain 0.024
Further Details:      
 
Domain Number 5 Region: 529-585
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000113
Family PHD domain 0.022
Further Details:      
 
Domain Number 6 Region: 342-408
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000421
Family PHD domain 0.029
Further Details:      
 
Domain Number 7 Region: 1148-1199
Classification Level Classification E-value
Superfamily HMG-box 0.000067
Family HMG-box 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0155599
Sequence length 1461
Comment (Drosophila grimshawi)
Sequence
MSFNMLGNMEDKAALTSLDDLPYFPEKYTGKVCCLCNLGERSALGQGTMFQLKVPSDFKE
KNSATQPSDADKEKVDSLRRIKCGLKTVSRAISNTESTYELDKIGYTDVLNTSSFLDDNF
VYVHRMCVMWSLRKVEVKEGDVTQFLTKLADYLEQKCSFCDQYGASINCKMNCRQMHHFP
CAAAAGCFLILESFTVFCTEHLSQVPLICSDNNVECLTCSSLGDLSKLIMCCSCGDHFHS
TCIGLANLPDTRSGWSCARCTKCQICRQQEANDIKFVKCEQCQKIYHANCLRPVISSIPK
YGWKCNRCRVCTDCGSRTPGGGSSSRWHSHYTICDSCYQQRNKGFSCPICQKAYRAAAYK
EMVKCSWCHKFVHSTCDEEADLTAYHKRKEYNPDYDYVCPVCKVGSNIKIEPLERSIADP
QASEHFSIRDVEVDPLNGKSCVELNSEDPLKLPTTKKKICLPSIRGKGGKFVLHRLGSMS
QIGKKRNNRGKGRQLVLHGGTSDRYMSRNHDTDNSSDKRLLLCSERDKFITSQDICVMCG
SVGVEGDAELITCAQCAQCYHPYCASVKHSRGILQKGWRCLDCTVCEGCGKKNDEARLLL
CDECDISYHIYCVNPPLEQVPRGNWKCSFCTICQKCGRNPTEKINHSDSNSPECPPCASQ
NSCSICSKGYSDGEMIIQCEQCEQWLHFLCDSINSQHTMDYYDHNMYKCIKCRSTGKTPM
PMSSTTLNENSALAKIPTPDQGHDGKAVGQNMRLTNELLESNEAIHWIDGVCLSENGLNM
IKSLSTEIKRKRKMRQPIGNSNKDAPNETGVSDDIQSDKYKDGMIWDRTEAALPEGFTIS
TNDDGVHILRKKRQRNLQKLGIGGFSVRNRAIKKDNEDAADQHANALASQDKKKKIIRKK
QKNKLIEAYPAYLQEAFFGKPLLESGDPVVYDSDTSDEIGTTMKMYFIHSNGKKSDDEAI
TKSPAKTLKKPKAEKILTENKNMFGDQFSTATQQNKDPVSAGVLFDTSLTDITRNTSANS
ILSLDPLAPKGITEVDVINKTVNFIATADNIKSEPLVTVNINNYAVPPQVTQEPKFHSKL
TPKSTQLQYQAESQNITGQQLPLQTEKREDPKPNEPSIECINAGTQKTAEKMRKDEDLGL
MATISAVLYANTEHANLKEVYPNWNDRCKQILKGWRSLCNEKKAPFLQKAKDNRSALRQR
REQCKVSQPTKPEKQEDNRTWKQQPCKPKEEQSNVFGNYNGISYDANCYIGPAMHHGNSH
HPTAISNASLIVKSAIQQRTTTTTIHPAPSSLKIASLENRTEHNPTFEPEPVGDKKLRNL
LQKTNSEAVIMNSNSEFFLPNDVMRMSLIQNTAITQNNPMLSMSGNPQHTELRSLEHDGK
SQLDMKMTEAQEGISSSAVELENVGFGDILGGFGEGDDDDLLKSLTSEIGDDFNILEYAD
PELDVNVLNTLDFEESEKNSA
Download sequence
Identical sequences B4J645
7222.FBpp0155599 FBpp0155599 XP_001987036.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]