SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0156001 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0156001
Domain Number 1 Region: 73-168
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000275
Family Insect pheromone/odorant-binding proteins 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0156001
Sequence length 232
Comment (Drosophila grimshawi)
Sequence
MGKKGKGKGNKLVKMSEEERARYLQMRADMEEETRRRKMKLIALYMKFAGAIQIDCDKTD
QIHEDQIHHCCKHPDGHNQIMADCAKEHGFKLPNSNKQSMMDLTAGHAIAGTCFAKCVFD
KLNFMKDDNLDMEAVKKSLLEKHSDDPEYVNEMIRAFNHCHGKAEENAAKFMSNSIFKHM
TKDFCEPKSAVIMACVIRQFFHNCPSFRWAKTEECENLLQFSRKCTDSIATL
Download sequence
Identical sequences B4J429
7222.FBpp0156001 FBpp0156001 XP_001987768.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]