SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0156667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0156667
Domain Number 1 Region: 56-78,124-188
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000589
Family Insect pheromone/odorant-binding proteins 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0156667
Sequence length 280
Comment (Drosophila grimshawi)
Sequence
MYTRITPLLALCLYLSNLPQLAWTRSLSVSLNMSLTRSEVEDENVTLTSAGAPQISQELL
QSCMRETEISMSQLKFFRLSMFFNENTNRELAMAAGDGDGDLNNGNLVDLDFDNTLPYLN
LKRNEPLQCFVRCLYENLGLVHYDMMLEDAFRMQLHTLMRRLKPELKECNEMTSKNRCEA
AYKLRLCYNHLKNLEAEQRLREVLEHSDSSTDLTATDNDENENGNENGNENGNENVSGHE
NENDGESEHENESVVRAANAKANEFIDAIRRYTEQTTETE
Download sequence
Identical sequences B4JWD1
XP_001995197.1.65300 7222.FBpp0156667 FBpp0156667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]