SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0157574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0157574
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000824
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0157574
Sequence length 205
Comment (Drosophila grimshawi)
Sequence
MKVLIVIGFTILIQLLLGQQSVGIRVHCRHVERIHENHIHLCCKHPDGHNDVTKMCAKQT
NFKLPTRNEEAIEDLTVDQVMTGSCWADCVFEHYKFMVNGSLDMEAVRSHYRTFHKQDPE
YETEMLIAFDRCHSKQEEATAEFLSSNAVRAFSSSKYCKPKASIILSCVIKNFFHNCPSS
RWSNTDECLETLAFAKKCKDVLTTM
Download sequence
Identical sequences B4J428
FBpp0153682 FBpp0157574 7222.FBpp0153682 7222.FBpp0157574 XP_001987767.1.65300 XP_001996993.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]