SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0158389 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0158389
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000471
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0158389
Sequence length 205
Comment (Drosophila grimshawi)
Sequence
MNVLIVTGFTILIQLLLGQQSVGIRVHCRHVERIHENHIHLCCKHPDGHNNVTEMCAKQT
NFKLPSKDEEAIEDLTVDQVMPGSCWADCVFEHYKFMVNGSLDMEAVRSHYRTFHKQDPE
YETEMLIAFERCHLKQEEGTPEFLSLNAVRAFSSSKYCKPKASIILSCVIKNFFHNCPSS
RWSNTDECLETLAFAKKCKDVLTTM
Download sequence
Identical sequences B4K243
7222.FBpp0158389 FBpp0158389 XP_001997347.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]