SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0070730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0070730
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.58e-58
Family N-terminal domain of xrcc1 0.0000274
Further Details:      
 
Domain Number 2 Region: 420-509
Classification Level Classification E-value
Superfamily BRCT domain 8.72e-23
Family DNA ligase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0070730
Sequence length 614
Comment (Drosophila melanogaster)
Sequence
MPIALFKSVREVSSEDAVHVAANLLKENAGKKWRTKAPGEKSAYVVLEFEEPQQITGIDI
GNEHAAFIEVLVSRTGCQADDFRELLLSSSFMTPIESKNSSNPNRVRCFSSTSLAESALP
EKWKLLQIVCTQPFNRHVPYGLSFVKVHVVAAAAPKVKSLVPQGVMQFGTFKLREESPDS
ETDNQVNRFHSWKKQTQHKSPAISATSTAAAIRDAGSTALRRLSAGKVSSLAASPKTSTS
PSPVLNALRSVSPTPLDAKPLDRNRASLLFGDDDEDVKDAEVNAKKQRLSKHLEADKDRR
RLEQEKERESRKKKSSRHSLDKSISKEDKPPAKEHNSSSREKSTAKEEKEQLRKEERSHS
KEEKSRRKEKSKHDHRSSDTSNSKESSRPTAQKRHSSPTAVAVTPAKKQKIVDTAIQYRP
LNQLLKGVVLVISGIQNPDRADLRSKAVALGAKYKADWGSGCTHLICAFKNTPKYNQVKG
KGKIVTRSWIEKCYELKKYLPWRRYALDTNDIGQPESDEELCDEATRPRRDSSKDDVAML
EDSKLTALADQNDVEMNPDALSGIDTEDELQRVAEENKTKKAKLRTTVKTKSQDIYEVST
DEEDYLELKKKQID
Download sequence
Identical sequences Q9Y095
FBpp0070730 NP_572217.1.81976 FBpp0070730 FBpp0070730 7227.FBpp0070730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]