SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0072561 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0072561
Domain Number 1 Region: 501-763
Classification Level Classification E-value
Superfamily TPR-like 3.7e-24
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 2 Region: 127-385
Classification Level Classification E-value
Superfamily TPR-like 1.25e-23
Family Tetratricopeptide repeat (TPR) 0.0071
Further Details:      
 
Domain Number 3 Region: 345-486
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000123
Family Tetratricopeptide repeat (TPR) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0072561
Sequence length 1150
Comment (Drosophila melanogaster)
Sequence
MSNCIEIPLQDTDEVIEVDPDQLPDCPEVLSILKQERAPLHVWVNVALAYYKQKKTEDFV
TLLEESRSDDATKEYRDSDKDLMRALDMLAAHYVQEAYREKSKDKKRELFMKATNLYTSA
DKIIMYDQSHLLGRAYFCLLEGDKMDQADAQFNFVLNQSPSNIPSLLGKACIAFNRKDYR
GAMAFYKKALRTNPNCPANVRIGMAHCFLKMGNPEKAKLAFERALQLDQQCVGALIGLAV
LKLNQLEPESNKLGVQMLSKAYTIDNANPMVLNHLANHFFFKKDYQKVHHLALHAFHNTE
NEAMRAESCYQLARSFHAQSDYDQAFQYYYQSTQIAPANFVLPHYGLGQMYIYRGDTENA
AQCFEKVLKIQPGNYETMKILGSLYAHSNSQTKRDMAKTHLKKVTEQFPEDIEAWIELAQ
ILEQNDLQASLSAYGTASSILRDKAKYEIPAEIQNNVASLHYRLGNLKMAKLTLESALKH
ATSEMDKDVKYYESIQVTMKYNLARLNEAMSSYDVADKLYKEILKEHPNYIDCYLRLGCM
ARDKGLIFVASDFFKDALNINNDNPDARSLLGNLHLAKMQFALGQKNFETILKNPSTSTD
AYSLIALGNFSLQTLHQPSRDKEKERKHQEKALAIFKQVLRNDPRNIWATNGIGAVLAHK
GCVIEARDIFAQVREATADFCDVWLNIAHVYVEQKQYISAIQMYENCMKKFYKHNNVEVM
QYLARAYLRANKLVDAKAVLLKARRVAPQDTVLLFNIAVVLSRLAMAILKDEKSTLEIVL
QAVHELELAQKYFQYLSVHGDKNRFNIEVAGIEASTCQDLLSQAQYHVGRARRIDEEERS
LRRKQEEEREAFKIKVAEQRKRREEEAKTSRDQLLAKRQEYVEKTKNMLIIADAPPEKER
KKGGGRGRKDDYISGTESDNDGARREGERPSKKKGKGERKKGGGRKRKTEKYESDSEEEP
GASGKSGKKKGKKPKPVKESKEKLSAKQRLKVLSKETISTSESESDGKRSKSRSRSRSRN
RSGSRSGSASRSGSDREASRKRSRSRSGSGSGSDSDEATKRKRARNRIESGGESDRSGSR
ARSKSSSRSRSRSKSGSRSRSRSKSGSRSRSRSKSGSRSRSRSPSGSRSRSRSGSRSKSE
SRSRSGSPEK
Download sequence
Identical sequences Q7K0X3
FBpp0072561 FBpp0072562 NP_788448.1.81976 NP_788449.1.81976 FBpp0072561 7227.FBpp0072561 FBpp0072561 FBpp0072562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]