SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0072679 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0072679
Domain Number 1 Region: 14-335
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-32
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 2 Region: 449-640
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000824
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 756-911
Classification Level Classification E-value
Superfamily TPR-like 0.0000844
Family HAT/Suf repeat 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0072679
Sequence length 1205
Comment (Drosophila melanogaster)
Sequence
MFVYLSKKIAIPNNVKLNCIAWNKEEGYIAVAGTDGLLKVLKLDQATPNGQSKGGLAAVS
NLSMNQTLDGHKESVRVVTWNDAQQKLTSSDTDGVIMVWMLYKGSWYEEMTNDRKKSTVA
SMSWTSDGSRICIVYEDGAIIVGSVDGNRIFGKELKGTHLTGVQWSPDNRLILFALANGE
CHLYDNQGNFAMKLHIQCVNISGGSSSRGHRIASICWFSGRVVQSRKRPVLAICYENGRV
QIMRNENDDAPAIFDTGMRNVDAKWNHDGTVLAICGTTLDAVSPTSQRDTNQVCFYSPLG
KIYRTLKVPGTDITSLSWEGKSLRIAMAVDSFIYFANIRPDYIWCYFEKTVVFLNSGSAT
RESPMSVITFWNTVSNQSFLKEVEPTLCLASSSEHCVLGVECVSSNIKEIALSTLENRSN
PADDRVYQLLLCNSIGTTVDSKYTDIRPCFVGINSSYVAIASQEEILIWHYHTPKSASTL
HNVKARKEKRFHIDDTPTGVEMAKDLMLSSSSGDGHSTQRGISDPICALALSEKLLLVAR
ESGAINEYSIANVALRNRHLMNAKVYKMAINCNSTRAAIIDHMGVMTLLDLDDNRETQLN
FSRVERKDVWAVSWATDNPLLLALMEKTRMYIFRGNDPEEPVSCSGYICTFEDLEITSVL
LDDIISVGELQNFSHIIQLRVKSLRDTDDLLEHVGLEDAKQFIEDNPHPRLWRLLAESAL
KKLELETAENAFVRCAHYPGIKLVKRLRTIHSKELQRAEISAFYGEFEEAEKLYLDADRR
DLAIELRMTLCDWFRVVQLYRMGGSGVSDQQMEIAWREIGHHFANLRSWESAREYYEKSH
YLEGYMEALYHLEQFDDLEKCVERLPEKSPLLPKLAEMLASVGMCSEAVQAHLRFGDQKA
AVATCVNLRQWGEAVELAQRFQLPQVQTLIAKHAAQLLQEGRLKEAIEMQRNAGRHLDAA
RLLSQMAEREQEKRAPLLRIKKLYVLAALLAEEHLKAVATTEIDYASGRNTLLDSIALED
AAAIERLWHCAEAYHFMLLAQRQLRFGIVHSAVVTAVRLRDYEDVLPPEHIYSLLALASC
ADRAFGTCSKAFMKLEQQAHLPEATLQRYEELAAGIFAKYDPEDTTGDRVDCYSCGVPVP
DSSPSCPECNARFPACISSGKPITQPTNNIWICTTCHHCAAPTEISRHRTCPLCHSLIVS
MTVEI
Download sequence
Identical sequences Q9W097
7227.FBpp0072679 NP_001261278.1.81976 NP_647653.1.81976 FBpp0072679 FBpp0306202 FBpp0072679 FBpp0072679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]