SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0072976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0072976
Domain Number 1 Region: 328-494,534-662,722-825
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.12e-77
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00096
Further Details:      
 
Domain Number 2 Region: 181-289
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-33
Family Zf-UBP 0.0000055
Further Details:      
 
Domain Number 3 Region: 690-738
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000296
Family UBA domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0072976
Sequence length 827
Comment (Drosophila melanogaster)
Sequence
MEELRKHLSKVNVPCASGAGSPPIYKDECVYSYDNPETPTGLYVCLHSFLGFGEAYVREY
ADKTGNRVFLHIQRVKTIKEGADMEAECAESEAGPERKITRLAIGVEGGYNESDMAKKYE
IKDTYSIVVAPHLDKKLPYPDPELPMRVTQSVEAILAADSAIAKLEKATLMGTWDGEVRQ
ASKYADNLQQLDNGKRIPPSGWQCEKCDLTNNLWLNLTDGSIMCGRKFFDGSGGNDHAVE
HYRVTGFPLAVKLGTITADGKSDVFSYPEDEMVLDPHLERHLSHFGINMAAMKKSEKSMV
ELELDINQRIGEWTALTESESELQPVAGPGYTGMRNLGNSCYINSVMQVLFVIPDFQQRF
VGTGAERYFKEFPSDPANDFNIQMAKLGTGLQSGKYSSIAENTLDTDHSTGISPAMFKNI
VGKNHPDFSTKQQQDANDFYLHLLTLLDRNSRNQTNPADALKFLLEDRVECLASHKVKYN
TREEYSFRLPVPLDKATNLDEVREFQERKKAARETGQRLPDRDIVRHKVPLQACLERFFG
PELIEQFYSTAIGSKTNARKITRLATMPDCLMIHVGKFTLGDDWVPKKLDVSVDMPDELD
LSNWRSAGGLQPGEEALPEPATEEVKFAFDEAVMSELLTMGFPPEACKRACYHTKNSGLE
AASNWLMEHIADEDISEPFVVPNNSIGDCAANQFVANPESLAMLMSMGFDERQAVAALKA
TDGNVERATDWIFSHADSIGVEDAAPAANSSAAAASSTPNKTNYRDGRGKYRLVAFISHM
GTSAQVGHYVCHIRKKGEWVIFNDSKVAKSQNPPKDLGYLYLYMREQ
Download sequence
Identical sequences Q9VZU7
FBpp0072976 FBpp0072976 FBpp0072976 FBpp0298309 NP_001246589.1.81976 NP_001334708.1.81976 NP_647773.1.81976 7227.FBpp0072976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]