SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0073231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0073231
Domain Number 1 Region: 140-430
Classification Level Classification E-value
Superfamily L domain-like 8.84e-42
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0073231
Sequence length 691
Comment (Drosophila melanogaster)
Sequence
MLPHHQRHKMATLADSAICFLLLSLLLIGACLVTPTEGRAKDDRRTRGRGSSSGVLSSSS
SSSNNMNNGYYSGSSSTAGSSSGYVFTSSSAVNSGSTGYSGPMDSTGFCTRRRDMKLMCY
CTPDENHVPVQKAECWVFSEGLHQNDTTWTRFYQQKRLRELKFVIQNNARLDYIPTMIIE
PLKNLSSIVIEYSQVEIVKSYAFANLPFLERIILNNNHIMALDQDAFANHIRLRELNLEH
NQIFEMDRYAFRNLPLCERLFLNNNNISTLHEGLFADMARLTFLNLAHNQINVLTSEIFR
GLGNLNVLKLTRNNLNFIGDTVFAELWSLSELELDDNRIERISERALDGLNTLKTLNLRN
NLLKKIDNGLLRGTPALLSINVQANKLETLTFYTFQPIMDNLVNSTSELLVSDNKFICDC
RLQWIFELKNRTRHLQLRDSLEDLHCTLQEPKLSHFVDPVPPTILDVLNIGGFTAIGSNS
ASMGGVGNSVVGSSYSGLTMDDSRKHLGSRSRQALRGQRQFASSAENVVESKMRRRRKRQ
EEVKEKDLAAVAPAHKRYDYYDDNNGGMSLGHGLDLDDNLSLHKQGFYGAGSPVVGHNDV
DVLMTSHSASGDALDILTTKNAIYIKLFLLKPEMLPCHDELSDPTELPLSRDLMDVRSNV
GQDMSTAGANSLAQGMTIIVSLVALMMISRG
Download sequence
Identical sequences Q6AWM0
FBpp0073231 FBpp0301699 7227.FBpp0073231 FBpp0073231 FBpp0073231 NP_001246635.1.81976 NP_523930.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]