SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0075591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0075591
Domain Number 1 Region: 53-160
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0075591
Sequence length 185
Comment (Drosophila melanogaster)
Sequence
MPQANLTLSPHDQQVLDSIFNPLELSSLQTNNLIPAESDLKDEEPDTQAIKASRELELKA
IALSESGELDGALELFQQSLNLAQRASVLNNRAQTLRLAKRDEEALDDLNKALELANDQQ
TRTKCHAHCQRGVLYRKLDNLEAARADFEAAAQLGSKFAREQLVEINPYAALCNQMLRQA
FDQLK
Download sequence
Identical sequences Q9VU70
FBpp0075591 FBpp0075591 NP_648644.1.81976 7227.FBpp0075591 FBpp0075591 FR703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]