SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0075730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0075730
Domain Number 1 Region: 46-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 179-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.95e-36
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 3 Region: 565-585,799-962
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.15e-33
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 364-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-25
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 970-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-24
Family Laminin G-like module 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0075730
Sequence length 1284
Comment (Drosophila melanogaster)
Sequence
MRPPRSNTKAAFSSLQFGLLCLLLLVNNGIKSVQADAFTDYFSDYDCNQPLMERAVLTAT
SSLTERGPDKARLNGNAAWTPVENTYNHFLTLDLGDPRMVRKIATMGRMHTDEFVTEYIV
QYSDDGEFWRSYVNPTSEPQMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDRISMRV
ELYGCDYISENLYFNGTGLVRYDLRREPITSTKESIRFRFKTAFANGVMMYSRGTQGDYY
ALQLKDNKMVLNLDLGSRVMTSLSVGSLLDDNVWHDVVISRNQRDIIFSVDRVIVRGRIQ
GEFTRLNLNRELYLGGVPNVQEGLIVQQNFSGCLENIYFNSTNFIRVMKDSTELGEGYLF
TRVNTIYACPSPPIYPVTFTTRSSFVRLKGYENSQRLNVSFYFRTYEETGVMLHHDFYSG
GYLKVFLEFGKVKIDLKVKDKARIILDNYDDQFNDGKWHSFVISIEKNRLILNIDQRPMT
TTKSMQVATGAQYYIAGGKDKNGFVGCMRLISVDGNYKLPQDWVKGEEVCCGDDVVVDAC
QMIDRCNPNPCQHKGLCHQNSREFFCDCGHTGYAGAVCHTSNNPLSCLALKNVQHVQQRV
NLNLDVDGSGPLEPFPVTCEFYSDGRVITTLSHSQEHTTTVDGFQEPGSFEQSIMYDANQ
LQIEALLNRSHSCWQRLSYSCRSSRLFNSPSEAGNFRPFSWWISRHNQPMDYWAGALPGS
RKCECGILGKCHDPTKWCNCDSNSLEWMEDGGDIREKEYLPVRAVKFGDTGTPLDEKMGR
YTLGPLRCEGDDLFSNVVTFRIADASINLPPFDMGHSGDIYLEFRTTQENSVIFHATGPT
DYIKLSLNGGNKLQFQYQAGSGPLGVNVGTSYHLNDNNWHTVSVERNRKEARLVVDGSIK
AEVREPPGPVRALHLTSDLVIGATTEYRDGYVGCIRALLLNGKMVDLKEYSKRGLYGIST
GCVGRCESNPCLNNGTCIERYDGYSCDCRWSAFKGPICADEIGVNLRSSSIIRYEFEGSF
RSTIAENIRVGFTTTIPKGFLLGFSSNLTGEYLTIQISNSGHLRCVFDFGFERQEIIFPK
KHFGLGQYHDMHFMRKNGGSTVVLKVDNYEPVEYNFDIKASADAQFNNIQYMYIGKNESM
TDGFVGCVSRVQFDDIYPLKLMFQQNPPKNVKSLGTQLTEDFCGVEPVTHPPIEIETRPP
PLVDEEKLRKAYNEVDSVLLACLLVILFLLLILMFFLIGRYLHRHKGDYLTHEDQGADGA
DDPDDAVLHSTTGHQVRKRTEIFI
Download sequence
Identical sequences Q94887
7227.FBpp0075730 FBpp0075730 FBpp0075730 NP_524034.2.81976 FBpp0075730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]