SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0076564 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0076564
Domain Number 1 Region: 122-421
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.28e-97
Family Pancreatic carboxypeptidases 0.0000476
Further Details:      
 
Domain Number 2 Region: 21-108
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 2.55e-17
Family Pancreatic carboxypeptidase, activation domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0076564
Sequence length 424
Comment (Drosophila melanogaster)
Sequence
MKFSLGLLVLFLGATLVAAEQDYEGYRIYEVIPSTADQADLLHQLSLQGYDFISETRLLG
HPSRVIVSPAQLKHFQQLVEAEKMTLTLVNSNLGASIAEEFAQRQMQRLLAPITGKGRLS
TERYYTHEEIINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDG
GFHAREWISPAAVLYVIDQLVEQFEENAHLLKDYDWVILPLVNADGYEHTQTGTLARMWR
KTRQPYTYAGQTCYGADPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHS
LADRGIMYLTLHSYGNYLLYPWGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSST
NVLYIAAGASDDYGYYAGFNVSITMELPGAGSIGFNPPVTRIDEFVTETWIGIRAMAEKV
IEMY
Download sequence
Identical sequences Q9VS66
NP_648118.1.81976 FBpp0076564 7227.FBpp0076564 FBpp0076564 FBpp0076564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]