SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0078163 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0078163
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 3.66e-33
Family Hypothetical protein c14orf129, hspc210 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0078163
Sequence length 158
Comment (Drosophila melanogaster)
Sequence
MGEPKATADPGEEQAFNCEDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESAT
CCVQVSSRGFKIVSSQYDTIDEDSRISALLRNGQEQGDDEEEEIFETPYALLDKISPRYV
ESFGNQLCQQLRALQQMRTEFNEEDEEEEEEAEEEEKK
Download sequence
Identical sequences Q9VNV2
FBpp0078163 NP_649386.1.81976 FBpp0078163 FBpp0078163 7227.FBpp0078163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]