SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0079111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0079111
Domain Number 1 Region: 262-377
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-30
Family Bromodomain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0079111
Sequence length 861
Comment (Drosophila melanogaster)
Sequence
MGSSKKHKKNKSERREKYEEYSQHQDPAQLQRGLKLILKVGSNATPEYSANSPMVDGGPP
TAAEAMMSPVPEELQDHQGHRERHKKSKKKKKKKDREKKHKHHKEKRHRSRDRHRDAGSD
EDMMAGADDAACSGFAPSSVAPPAADPDSSQDGFSFMDDDQSQPLPENILFFAGITTDNS
PSNCPVTKPIAPRKLDDILMGSSPNSSSLQSSSLGLIGSSPTKPLPDLLIPSPSTPGGAN
SLNALTPKALEAPKTPSSSSESGREPRSCVLKLKQQKSPLNKLLEHLLRFLEKRDPHQFF
AWPVTDDMAPGYSSIISRPMDFSTMRQKIDDHEYTALTEFTDDFKLMCENAIKYNHVDTV
YNKAAKRLLQVGMKHLQPENLMRSLKPLSGYMRELTARELGFELSSNDMSRENNDSADEG
ASTGAEEPRTPAQLEEEERKRTLRLENAPKTHFEPYVDDLTGEEILAQVQNAAQQAKQRV
NAKKNAHKMGFLRQMKDGTTTLNLVIKEENEGPERVVTIGDLVGKLQKGSAQLQTRQVDK
RNAVRTVKSLNYGAFASFAPTFDSRFSTLSAEETQLVLRTYGDASSAEYAESILQFTKDS
NYGTTIANGLLDILTNGEHSKSLDELYNMQLHSYEQREIEKCFEQEEETSSQQETTAQIE
QEYEKYKNTHVDFKGLQSLGELGIDVSFLDGMEAEMKSYELNRRMHEHLSQNLTLIEKLR
VAQHDRLSQPLPNHLGLVQPAGQEEIQTAQQLTQQISDLAKKLPPSAIADPYALRKAMGM
SYAGLPPPRPVSPRVQLPELLQQPVALPQLQPVAMEIDESDEQHGGGDLENELREFLESG
SGLHSANPADDNSIVAQLLLN
Download sequence
Identical sequences Q9VLX2
NP_609148.1.81976 FBpp0079111 7227.FBpp0079111 FBpp0079111 FBpp0079111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]