SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0080156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0080156
Domain Number 1 Region: 193-320
Classification Level Classification E-value
Superfamily NRDP1 C-terminal domain-like 1.83e-56
Family USP8 interacting domain 0.0000659
Further Details:      
 
Domain Number 2 Region: 7-87
Classification Level Classification E-value
Superfamily RING/U-box 2.36e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 79-135
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000216
Family SIAH, seven in absentia homolog 0.009
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0080156
Domain Number - Region: 137-200
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0301
Family C-terminal domain of PLC-beta 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0080156
Sequence length 328
Comment (Drosophila melanogaster)
Sequence
MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGL
LTSHLVPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGC
GMKVPKDEMSRHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAAL
RSTNPMLRNIGEQLDRFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPM
HMLNMLVERCHEDRWPEGLMTLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGENTHM
PENLRPILGLVMIFVDGVNEVIFGEEII
Download sequence
Identical sequences Q9VJW5
NP_001285905.1.81976 NP_609668.2.81976 FBpp0080156 FBpp0080156 FBpp0080156 7227.FBpp0080156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]