SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0080229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0080229
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000412
Family ZZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0080229
Sequence length 349
Comment (Drosophila melanogaster)
Sequence
MGHRNICCNGCQMTIFQGSRFRCLRCVNYNLCDICYDHQIETEEHRANHPMQLFPDSDDL
VPLLYGEIPELVHLSNCFTCPHCGLLALTAKRFIEHVYVQHRVSNEYVVCPMCAGLSAAE
LVAIRHLSKHLLHNHIDHANYLEPDTPPLRRIFTRNHMRHHRQSQLQTTPNSRIFDISVW
LSTGRVSSDPQLLSNNDPPEEAANSESLALGLSSGGPFEHDDDRYVLLQWIAQQKVQCHD
TDESQRLRRTLFVEHLLISMLCCEELQLPDGDRRIREGNGESDLDQENHSSLVKVMSVMS
LPWTGVWQTNQLDGSEGEGEIRAAKKDGVDLDKVQIEEHKRVAAEEAID
Download sequence
Identical sequences Q7KT86
NP_001162977.1.81976 NP_723881.1.81976 FBpp0080229 FBpp0290952 FBpp0080229 FBpp0290952 7227.FBpp0080229 FBpp0080229 FBpp0290952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]