SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0080535 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0080535
Domain Number 1 Region: 115-235
Classification Level Classification E-value
Superfamily TPR-like 5.14e-33
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0080535
Sequence length 331
Comment (Drosophila melanogaster)
Sequence
MPDAVQQSFVRSFIDYLKKQGDVMSPDQTESIEVAIQCLQAAFDLGDDVEAAPAAAGEEQ
ATTQSSSTASAPDDDAVASGSAGIGAAAAAVPNNIDMFELFQSLYTERNPESLALAESIK
NEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSALVYN
NNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEVYKSNLEAARNARNQPPQTGRL
REDLINMLSQPMVRNLFNNAEIDVEQLLSMLQNPMIMNTIRQQFGGGNAPTLPNDMVQMI
YNMTSQLTGFPNSNANPGNEQQPGNQPPPST
Download sequence
Identical sequences Q9VJD4
7227.FBpp0080535 NP_001246058.1.81976 NP_609842.1.81976 FBpp0080535 FR694 FBpp0080535 FBpp0080535 FBpp0296963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]