SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0081805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0081805
Domain Number 1 Region: 302-420
Classification Level Classification E-value
Superfamily TPR-like 7.32e-18
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0081805
Sequence length 872
Comment (Drosophila melanogaster)
Sequence
MNFDYIGQALGYHGQPLQKIWDDERGVDDLRLMGLTQVNYGVYQERQKYFTFQERAKRLK
MHQFLARKATDLYDRTLVANVMEDSLLAQGNTYMTQMAPFEFFLNVKDKRKGWAHRLSAL
KQGDIIYTQVTRLASGNRLIVKPLCTAEPKHAYLADIPIKAVILQDFWGPLPLDKQGNPR
SFVQNDILRCEINNISADTERLSLNMIGMFNKVPDLKFGLCDFKELPKYYSKIHNLDHPS
ASHYEDELNKALEFENPNYDLLFQMNGLQPNENLSLMSYLRAGFPEEENAAELRQKQASQ
WAFRSVADGIEHFKNGQQVEAFQCLNKALNIDPRNVEALVARGALYANRGSFLKGLQDFE
KALHLNKYHVNARKYMGETLVALGRSYEEENRIAEAVKAYSDCLNLLPLHEEARQSLDAL
HRSGDGKRRISTEPSNMTGGQSSDESSSSSASDSECEDSAGKPKSNISQPFYAQHKLKQS
GDEKLAVIDAHKANEFRLDDDETVSSVRKLLREASKHKKAKKKGKKKKDKKERRRSRTKS
ETEDPIELLKKIDFQEALRQDNKLMNSTRSDEERKAKIKSYLKEGGKESPPPPPPMKKTA
VSSRKSSFDNVGPSTSRHAASVVGFGGAQPPPAPKFLGQKKHPEPAPKLSFQIKKRPLQM
DKLGMLRLAAPAEPLKGGRSSSSRSRSRSRSRSRSRSRNRRLGRSTRSSLRSRRSGSRSR
SISRSRSRRRRTYSRSRSPSPRSYGNRFVIGRYRNRRTRRSRSFHRRRSPSPILKRRSPS
PFVPRRTPSPASRYRRSRSRSRSRSRSRSPRRFQSRYMPRDRGSVNRSRYSWHNPHKRSV
SRTVEPNGKDERAATPPKKGVADDRSGREERA
Download sequence
Identical sequences Q9VGU5
NP_650036.2.81976 7227.FBpp0081805 FBpp0081805 FBpp0081805 FBpp0081805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]