SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0081961 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0081961
Domain Number 1 Region: 24-355
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.49e-91
Family Glycosyl hydrolases family 35 catalytic domain 0.00052
Further Details:      
 
Domain Number 2 Region: 471-512,541-621
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-34
Family Beta-galactosidase LacA, domains 4 and 5 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0081961
Sequence length 637
Comment (Drosophila melanogaster)
Sequence
MKFSVVVLVALLPLLGAVSANRTFVVDYEKDQFLKDGEPFRFIAGSFHYFRAHPATWQRH
LRTMRAAGLNAVTTYVEWSLHNPRDGVYVWSGIADLEHFIRLAVGEDLLVILRPGPYICA
ERDMGGFPYWLLNKYPGIQLRTADVNYLSEIRIWYTQLFAKMNKYLYGNGGPIIMVQVEN
EYGSFYACDLNYRNWLRDETESHVKGQAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLK
PIWAKFRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFY
GGTNFGFTAGANDIGPGNYMADITSYDYDAPMTEAGDPTPKYQALRRIIGRYLPLPNQPV
PGPVPKRSYGTVRLTTCCSLLSSEARSRLSTGFVQSAKPKSFEALGQYSGLVLYETWLPS
FQRDPSILSVPGLADRGYVYVDGEFVGILARETPVFELPLSASAGRRFQIIVENQGRINY
GRQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDNLEQLITQSDEAVRQGFQELKKLRT
MLRTGPAIYHGQLDIQKESDLADTYLDMSGWGKGIVFVNGENLGRYWPLVGPQVTLYVPA
AVLKAGSNRLVVVEYQQTPASQELHFRDTPILNARTV
Download sequence
Identical sequences Q9VGE7
FBpp0081961 7227.FBpp0081961 FBpp0081961 NP_650142.1.81976 FBpp0081961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]