SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0082420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0082420
Domain Number 1 Region: 77-153
Classification Level Classification E-value
Superfamily TPR-like 0.000000011
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0082420
Sequence length 374
Comment (Drosophila melanogaster)
Sequence
MSNLLYMDKSNGNGVYAVRPNSSNGHMDNDNGLNGSGAPATTSTTTGTATAAGAALMATA
NNINIMNGAAAAAAASASGLPTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLK
DYKKALKYCKLILQYEPDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHA
SDVEADVDGDEAGDADEDGDADADGDGSESSNNCSEEEDNGWGDDEIDNVDVMDGEEESS
SSGDDFDLPIDDAGQDPAALAVHVHHSHTHSHSHSHNDSGSSRNSSSGGGGRSDNTTHSY
SSLLLEEEDDIVPVSLNFGLKENTAADLDVSNGNKVPSASCSDSESPTEPLTQRLAAILR
SKCGVSGGGSDETY
Download sequence
Identical sequences Q9VFH8
FBpp0082419 FBpp0082420 FBpp0306145 FBpp0082419 FBpp0082419 FBpp0082420 7227.FBpp0082420 NP_001262573.1.81976 NP_650376.1.81976 NP_731925.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]