SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0082819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0082819
Domain Number 1 Region: 62-228
Classification Level Classification E-value
Superfamily TPR-like 3.21e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0082819
Sequence length 282
Comment (Drosophila melanogaster)
Sequence
MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIA
ALDTARFDIATKCTKQLALEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAA
PRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVL
LHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNS
RAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEIKSN
Download sequence
Identical sequences Q9VEQ2
FR684 NP_001262651.1.81976 NP_650580.1.81976 FBpp0082819 FBpp0082819 7227.FBpp0082819 FBpp0082819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]