SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0083079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0083079
Domain Number 1 Region: 84-424
Classification Level Classification E-value
Superfamily L domain-like 6.26e-41
Family Ngr ectodomain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0083079
Sequence length 537
Comment (Drosophila melanogaster)
Sequence
MKHKLLLLFLAGAALLLATEVRSQHEDIPYQPVSNICQTCLCLSTQDVDHRTHFNLDCSV
RNFEHILARWPEQFGSQAIASGAASEIVVSYSGNRIKLLQQLPATNASLTLSCRHCGLQD
LQAPLFMDVPNVQALYISWNDITDDALVPDLFRGPFRNTRYEPIGLRDLDLSHNRIVRLD
RRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGLMTLPAQLFSKLTS
LRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRLNISSMPSL
RSLEKGALNLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATGSSN
NSSNSTNETWPRLRRMSISGNPWYCSCELFKALELIGLNHIDREWDGTEARCETPYLLAG
SPLSNLTAERICKMVIPKKYREVDEEPPRFLRRHYIILTAIIASIVLVIGLVIGFVVVCV
RRRLKGSDYGVQPIRYTSVRGSNLSQFSQLQPVSVASKFNNVHAGSSSGVTTGAANA
Download sequence
Identical sequences Q9VE49
FBpp0083079 FBpp0083080 7227.FBpp0083079 NP_650740.1.81976 NP_732365.1.81976 FBpp0083079 FBpp0083080 FBpp0083079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]