SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0084458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0084458
Domain Number 1 Region: 328-445
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.44e-43
Family ets domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 176-270
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-27
Family Pointed domain 0.0013
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0084458
Domain Number - Region: 43-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0672
Family Ubiquitin-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0084458
Sequence length 464
Comment (Drosophila melanogaster)
Sequence
MNSSNDLSDELIRRLSVGGALEEVIASEMFEDSIDVETEAEPDDIIIVHMDIREPLSMLK
SLVEQKIGVCLNYYTFWLQDAQELESHKNLVDQCVKGEGLVQINVQIQTIRKRINIADVL
KPTEAALAALAEEVVGQLSPPETASQKSSSSESPIKTPLKRMHKEDSEEESVEGKDVKPV
LNWVLDSKFKREQIRLKIPEAANEWTHAHVTYWLEWAVKQFELVGINMSDWQMNGQELCA
MTHEEFNQKLPRDPGNIFWTHLQLLKECNFVSVVHKRAEEQRKPKQPRIMSANSISTNSG
GSLSLEQRIMRKSYQSVKSSDSVESTTSSMNPSNYTTIGSGNNGQVQLWQFLLEILTDCE
HTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKR
FAYKFDCDLKLLIGYDANELSTLVSEGKTAPERVAATETITEDT
Download sequence
Identical sequences Q04688
FBpp0084458 NP_524523.2.81976 FBpp0084458 FBpp0084458 7227.FBpp0084458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]