SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0085871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0085871
Domain Number 1 Region: 214-446
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-33
Family Kelch motif 0.013
Further Details:      
 
Domain Number 2 Region: 457-554
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000222
Family Kelch motif 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0085871
Sequence length 627
Comment (Drosophila melanogaster)
Sequence
MNNNSLLRYQNSKLIESVMNILNPGKFKCIVFDQLRHTWTFLLFICDFLAKIYRTPRITA
HQEQLANHNNNNNNNNDLIMEQDMPEEEVGQPEEALPQQDNGEVVDRFNAIQAAVELMDA
ASDLDEEEEEEDDDVDVDVDYGDTDSESEFEEMYSDEWTSSSDELDEGTELSKSVLNVFL
SSDKQQSQMAGQIPMYAFQPLRLVKCQYRDKHIPGGFPLARSGHRIIASNSHLYSLGGYN
PRSAMSASRHGRCLLFQELWSYNFATRTWRLELNAGNAANMPVELASNALTIHNNVLISH
GGTGYPFGVSCSNDCYVYRTASAGATPGVDRLQVKGDLPTAQYGPGIVIHKHFLYTIGGT
TGFDYTCDVYRLDLRTGIWENVYISRPEMRDDPEGRYRHEVVYDGKHIFVLGGGTSHSVY
DLQRIPAYNLEANCWDYFETYPDQRAADADDGNRGYPKPRKCFSCVQHQSSTGDIEAFIT
GGLQGDFSTYFSDIWKLNLRTKHWYRIETAILPRPLYFHSAAHSDNGCMYVFGGIEYIDK
EMRRRNDLYKMWMTVPKLSEMCWDAITYYNDNLDLYDRKTLLEAGIPKRFTERLPPQRRR
RLDTSQPDPSMLISLYSNPKRARSSTQ
Download sequence
Identical sequences FBpp0085871 FBpp0085871 7227.FBpp0085871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]