SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0086681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0086681
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000654
Family Insect pheromone/odorant-binding proteins 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0086681
Sequence length 218
Comment (Drosophila melanogaster)
Sequence
MCFCCARLISGSSRNWSYKVSRRCQTKLRLTKKMARHIALLICSLLAMAGCDPIDVDCTR
RQDFNIVKDCCVYPTFRFDQFKSQCGKYMPVGAPRISPCLYECIFNKTNTVVDGAIHPDN
ARLMLEKLFGNQDFEEAYFNGLMGCSDSVQEMISNRRSRPQRKTEQCSPFSLFYGICAQR
YVFNHCPSSSWSGTESCEMARLQNMNCSKPSRGSSHRL
Download sequence
Identical sequences Q4V3M8
FBpp0292336 7227.FBpp0086681 FBpp0292336 FBpp0292336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]