SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0086985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0086985
Domain Number 1 Region: 82-136
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000942
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0086985
Sequence length 212
Comment (Drosophila melanogaster)
Sequence
MLSKSQLLLLVVGFCLNAAVSADVDCSKRPSFVNPKTCCPMPDFVTAELKQKCIKFDMTP
PPPPDGEASGSFESKRRHHHPHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQEVFEDSS
DLQTTATQAFTTCATKVADFEANLPPRPAPSPPPGFPMCPHDAGHLMGCVFRNMMKNCPD
SIRNDSQQCTDMKEFFTKCKPPRGPPPSAEDM
Download sequence
Identical sequences Q7JVM1
NP_610812.1.81976 7227.FBpp0086985 FBpp0086985 FBpp0086985 FBpp0086985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]