SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0087349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0087349
Domain Number 1 Region: 776-859
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000742
Family RING finger domain, C3HC4 0.0022
Further Details:      
 
Domain Number 2 Region: 977-1018
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000212
Family RING finger domain, C3HC4 0.0042
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0087349
Domain Number - Region: 933-960
Classification Level Classification E-value
Superfamily RING/U-box 0.000459
Family IBR domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0087349
Sequence length 1102
Comment (Drosophila melanogaster)
Sequence
MRPPMAMPSMQASTGLQPTEVHPVQQLHLHATPSNPSDIHQDRSPHNHNAKLPPLELLVE
NKISYSSYQQHAKDLKHQSHNQNRSKRSSLSSPSSSEDCVSAARANIFDDAAENFVINFP
SESATSQHLLPLSETVPLLTHIEATVVDKQRSIRLNKNSASLIFTKKELNQGTREHHHQH
NNQQHQQQQRRPHHSSLYGVGRKPTKHLPPTRGHHQRRSLPLSYNNNLVTTAPSAGGAGG
PGGAAKLVPLKQQHQHHGAGHTAPPTANVVVAGGAGAAAPSARKQLSYSWYAPVYSALEE
ELEQDSRDSSPIHNLANTKQHQRSASQKASTALHATPRHDRAHDSADAETVALLDTQTRS
KIIISSANGDAGGAGAGVGFGGGGGGGSGNGGVLAANGGGDLESSLGLSGGGQLPRRRRI
ENFLKSLVGLKASSGRGGGGGGNVGGGGAVPDRERPASPEIRITRTPSEQDVVLRDPSGR
QLANGHGRGSLSISGSSSSLNVVQQKIWHIMRREGSASSLHQEKSQSIVQYTGLRKCETV
LALTRQSQSHGHVHGLSQSRSQGHSLAVHGSGIFSSGGVEQIRPLNRLRNSVSSINGVGT
CSRCSSLLSLAASGSRYSLSNGFAPRPTSALNHLEAGWEDDQRRAQEPHINVNAQIRLSG
GATANSTSPSPPSNVTTATLHSSSANNLNQEPQQSTSTPATTPTETPGSGELGPFGTNHA
YPLTVSSLLSMASANQAAQACCVRDGIALKRREMLASADVTPSVGTPATPTTAFKPFTCK
LCLIDVEDVGEAMALQQCGCQFCIECMRAYVEFEISEGAYEISCPDATCPAQGAISLPEI
ANLTTTNLLKKHHRYRLNREIELDKTRTWCPRAGCETICTVGAAAQPGQSSVICQMDESP
STSQSYSPQQEVAGNGSTGAAAGNGAPVLSVSVHCPSCKDEFCGLCKKAYHPNISCDEFG
RRLIADGQDDIGIPFDNELIKCCPMCAVPIEKDEGCAQMMCKRCKHVFCWYCLASLDDDF
LLRHYDKGPCKNKLGHSRASVVWHRAQVIGIFAGFGILLLVASPLLLLAAPCIICCKCRG
CTGSKIDEVDAELEEEVTALQG
Download sequence
Identical sequences Q7JR34
NP_001188904.1.81976 NP_788324.1.81976 FBpp0087349 FBpp0087349 FBpp0291679 7227.FBpp0087349 FBpp0087349 FBpp0291679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]