SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0087943 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0087943
Domain Number 1 Region: 79-423
Classification Level Classification E-value
Superfamily L domain-like 7.37e-56
Family Internalin LRR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0087943
Sequence length 470
Comment (Drosophila melanogaster)
Sequence
MAGIQLQSGCTMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCICTVKKNGLDIL
CETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIE
ENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLE
ILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRT
ISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEEN
LQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDI
KVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPK
LLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHCAGLNIIGNP
Download sequence
Identical sequences Q7K2X5
FBpp0087943 NP_610346.1.81976 7227.FBpp0087943 FBpp0087943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]