SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0111417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0111417
Domain Number 1 Region: 33-81
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-16
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0111417
Sequence length 108
Comment (Drosophila melanogaster)
Sequence
MPQIMNSKDKRNPNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYN
WIRSQKYQAKCPYCQSLIGENTLITITMRRRRTYFRANPLWSTAARCA
Download sequence
Identical sequences A1A749
7227.FBpp0111417 FBpp0111417 FBpp0111417 FBpp0111417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]