SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0288481 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0288481
Domain Number 1 Region: 27-312
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.56e-32
Family WD40-repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0288481
Domain Number - Region: 289-381,417-577
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00341
Family DPP6 N-terminal domain-like 0.042
Further Details:      
 
Domain Number - Region: 586-668
Classification Level Classification E-value
Superfamily TPR-like 0.0144
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0288481
Sequence length 775
Comment (Drosophila melanogaster)
Sequence
MKLKTRICKKNSIRNSEKVEESSKSTTNCPLSCVDWSSNEEIYFVSDDHQIFKWSDVSRD
SVEVAKLPDDFVPTDMHWLLLGGRSSGGGKGSDTLLICSNDGRFVILNKSARVERSISAH
AAAISSGRWSPDGAGLLTAGEDGVIKIWSRSGMLRSTVVQNEESIRCARWAPNSNSIVFC
QGGHISIKPLAANSKIIRWRAHDGLVLSLSWSTQSNIIASGGEDFRFKIWDAQGANLFTS
AAEEYAITSVAFNPEKDYLLVGTFNLLKLCHSNGWSYNTARFSSPRVGSIFNLSWSADGT
QATCGTSTGQLIVAYAIEQQLVSGNLKATSKSRKSITLKDIATGTQDILDFPQRVVSFGL
GYGHLVVATTNQVHIYNEKYINTPIIIDGRNDTRVIEVGKKYFMILDALSIWVYTYTGRL
HLNPRYPGSQAQIPLLTWRSLSLGLDVLAIRDNSDPTVLHLFDLIPGASRQYDPHSLRAK
QQLVQIAACRAGSPEDQFVAFIDSNRELFVSESRNLNSERIDEIYKIGTQLTAIMWASET
NILVGVHDSCYSIWYCPGEGASDPTIIALTTITLDTTEFGKHITIESFEESVLTFRSAGA
LLPVNVNMYCEILHRALLEGQWQQALKICRMGQHSSLWATLAAVATRKHQLQISEEAYSA
ALQIDKVSYLQHLKALTPSSAEQMAENSLMLGRMLEAETILLHGKKIEQAVGLALRMHNW
RRALEISQKHKGEQPELVPRVLQERRKYLKALQREEWDPLYLPLVAKEEADNTSE
Download sequence
Identical sequences Q9VII8
NP_610064.2.81976 FBpp0288481 FBpp0288481 7227.FBpp0288481 FBpp0288481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]